![]() |
[va1bijA-1dshA]
Comments: "CROSSLINKED, DEOXY HUMAN HEMOGLOBIN A" vs. "Structure and oxygen affinity of crystalline desArg141 alpha human hemoglobin A in the T state."
Other visual representations: Create new custom MPEG of this morph Color protein by motion View interpolation animated in Protein Explorer
(Rotate, color, render as desired. Requires PC/Mac, Chime)Color protein by nma flexibility View as Flickerbook Page in Adobe PDF 1.2 Color protein by b-factors 3D jmol viewer (NEW!)
Downloads and other analyses: Download interpolation as tar'red and gzipped PDB file Torsion angle analysis of morph Download interpolation as gzip'ped NMR format PDB file Proflex Analysis Helical interaction analysis of first or last frame.
Alignment of Protein Structures from Amino Acids in their SEQRES decks:
View alignment as nicely formated Alscript page (PDF format)
1>P1;1dsh.pdb.....1.VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKL 2>P1;1bij.pdb.....1.VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKL 1>P1;1dsh.pdb...101.LSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY. 2>P1;1bij.pdb...101.LSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
![]()
![]()
![]()
Copyright 1995-2005 M. Gerstein, W. Krebs, S. Flores, N. Echols, and others
Email: Mark.Gerstein _at_ yale.edu