[578061-5920]

Representation Video Format
Ribbon MultiGif
CA trace
Ball-and-Stick
Hinge
Custom PyMOL MPEG movies:
cpk-small.mpg
ribbons-small.mpg

Other visual representations:
Create new custom MPEG of this morph Color protein by motion
View interpolation animated in Protein Explorer
(Rotate, color, render as desired. Requires PC/Mac, Chime)
Color protein by nma flexibility
View as Flickerbook Page in Adobe PDF 1.2 Color protein by b-factors
3D jmol viewer (NEW!)

Downloads and other analyses:
Download interpolation as tar'red and gzipped PDB file Torsion angle analysis of morph
Download interpolation as gzip'ped NMR format PDB file Proflex Analysis
Helical interaction analysis of first or last frame.  


Alignment of Protein Structures from Amino Acids in their SEQRES decks:

View alignment as nicely formated Alscript page (PDF format)

1>P1;webupload2.pdb.....1.IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
2>P1;webupload1.pdb.....1.IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG

[help] [home] [movies]
Copyright 1995-2005 M. Gerstein, W. Krebs, S. Flores, N. Echols, and others
Email: Mark.Gerstein _at_ yale.edu